EPS8 antibody (70R-3683)

Rabbit polyclonal EPS8 antibody raised against the middle region of EPS8

Synonyms Polyclonal EPS8 antibody, Anti-EPS8 antibody, EPS-8 antibody, EPS 8, EPS8, Epidermal Growth Factor Receptor Pathway Substrate 8 antibody, EPS 8 antibody, EPS-8
Specificity EPS8 antibody was raised against the middle region of EPS8
Cross Reactivity Human, Mouse
Applications WB
Immunogen EPS8 antibody was raised using the middle region of EPS8 corresponding to a region with amino acids VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH
Assay Information EPS8 Blocking Peptide, catalog no. 33R-9810, is also available for use as a blocking control in assays to test for specificity of this EPS8 antibody


Western Blot analysis using EPS8 antibody (70R-3683)

EPS8 antibody (70R-3683) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPS8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EPS8 antibody (70R-3683) | EPS8 antibody (70R-3683) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors