EPS8L1 antibody (70R-3570)

Rabbit polyclonal EPS8L1 antibody raised against the middle region of EPS8L1

Synonyms Polyclonal EPS8L1 antibody, Anti-EPS8L1 antibody, EPS8R1 antibody, FLJ20258 antibody, Eps8-Like 1 antibody, MGC23164 antibody, EPS 8, EPS-8, PP10566 antibody, EPS-8 antibody, MGC4642 antibody, EPS 8 antibody, EPS8, DRC3 antibody
Specificity EPS8L1 antibody was raised against the middle region of EPS8L1
Cross Reactivity Human
Applications WB
Immunogen EPS8L1 antibody was raised using the middle region of EPS8L1 corresponding to a region with amino acids LQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEG
Assay Information EPS8L1 Blocking Peptide, catalog no. 33R-5318, is also available for use as a blocking control in assays to test for specificity of this EPS8L1 antibody

Images

Western Blot analysis using EPS8L1 antibody (70R-3570)

EPS8L1 antibody (70R-3570) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPS8L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EPS8L1 a protein that is related to epidermal growth factor receptor pathway substrate 8 (EPS8), a substrate for the epidermal growth factor receptor. The function of this protein is unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EPS8L1 antibody (70R-3570) | EPS8L1 antibody (70R-3570) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors