Epsilon Tubulin 1 antibody (70R-5640)

Rabbit polyclonal Epsilon Tubulin 1 antibody raised against the middle region of TUBE1

Synonyms Polyclonal Epsilon Tubulin 1 antibody, Anti-Epsilon Tubulin 1 antibody, FLJ22589 antibody, TUBE antibody, dJ142L7.2 antibody, TUBE1 antibody
Specificity Epsilon Tubulin 1 antibody was raised against the middle region of TUBE1
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA
Assay Information Epsilon Tubulin 1 Blocking Peptide, catalog no. 33R-3777, is also available for use as a blocking control in assays to test for specificity of this Epsilon Tubulin 1 antibody

Images

Western Blot analysis using Epsilon Tubulin 1 antibody (70R-5640)

Epsilon Tubulin 1 antibody (70R-5640) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TUBE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Epsilon Tubulin 1 antibody (70R-5640) | Epsilon Tubulin 1 antibody (70R-5640) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors