Epsin 2 antibody (70R-2205)
Rabbit polyclonal Epsin 2 antibody raised against the middle region of EPN2
Overview
Overview
Synonyms | Polyclonal Epsin 2 antibody, Anti-Epsin 2 antibody, EHB21 antibody, EPN2 antibody, KIAA1065 antibody |
---|---|
Specificity | Epsin 2 antibody was raised against the middle region of EPN2 |
Cross Reactivity | Human |
Applications | WB |
Immunogen | Epsin 2 antibody was raised using the middle region of EPN2 corresponding to a region with amino acids SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAM |
Assay Information | Epsin 2 Blocking Peptide, catalog no. 33R-8516, is also available for use as a blocking control in assays to test for specificity of this Epsin 2 antibody |
Images
Western Blot analysis using Epsin 2 antibody (70R-2205)
Epsin 2 antibody (70R-2205) used at 1 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Affinity purified |
Molecular Weight | 62 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPN2 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 1 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | This protein interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. It is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product