Epsin 2 antibody (70R-2205)
Rabbit polyclonal Epsin 2 antibody raised against the middle region of EPN2
Overview
Overview
| Synonyms | Polyclonal Epsin 2 antibody, Anti-Epsin 2 antibody, EHB21 antibody, EPN2 antibody, KIAA1065 antibody |
|---|---|
| Specificity | Epsin 2 antibody was raised against the middle region of EPN2 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | Epsin 2 antibody was raised using the middle region of EPN2 corresponding to a region with amino acids SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAM |
| Assay Information | Epsin 2 Blocking Peptide, catalog no. 33R-8516, is also available for use as a blocking control in assays to test for specificity of this Epsin 2 antibody |
Images
Western Blot analysis using Epsin 2 antibody (70R-2205)
Epsin 2 antibody (70R-2205) used at 1 ug/ml to detect target protein.
Epsin 2 antibody
Western Blot analysis using Epsin 2 antibody (70R-2205)
Epsin 2 antibody (70R-2205) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 62 kDa (MW of target protein) |
| Form & Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPN2 antibody in PBS |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This protein interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. It is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product
