EPSTI1 antibody (70R-7096)

Rabbit polyclonal EPSTI1 antibody

Synonyms Polyclonal EPSTI1 antibody, Anti-EPSTI1 antibody, BRESI1 antibody, MGC29634 antibody, Epithelial Stromal Interaction 1 antibody
Cross Reactivity Human
Applications WB
Immunogen EPSTI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK
Assay Information EPSTI1 Blocking Peptide, catalog no. 33R-8148, is also available for use as a blocking control in assays to test for specificity of this EPSTI1 antibody

Images

Western Blot analysis using EPSTI1 antibody (70R-7096)

EPSTI1 antibody (70R-7096) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPSTI1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EPSTI1 was up-regulated in breast carcinomas. The exact function of EPSTI1 is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EPSTI1 antibody (70R-7096) | EPSTI1 antibody (70R-7096) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors