EPX antibody (70R-5444)

Rabbit polyclonal EPX antibody raised against the middle region of EPX

Synonyms Polyclonal EPX antibody, Anti-EPX antibody, EPO antibody, EPX-PEN antibody, Eosinophil Peroxidase antibody, EPP antibody
Specificity EPX antibody was raised against the middle region of EPX
Cross Reactivity Human,Mouse
Applications WB
Immunogen EPX antibody was raised using the middle region of EPX corresponding to a region with amino acids LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDP
Assay Information EPX Blocking Peptide, catalog no. 33R-4765, is also available for use as a blocking control in assays to test for specificity of this EPX antibody

Images

Western Blot analysis using EPX antibody (70R-5444)

EPX antibody (70R-5444) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPX antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EPX belongs to the peroxidase family, XPO subfamily. Defects in EPX are the cause of eosinophil peroxidase deficiency (EPD).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EPX antibody (70R-5444) | EPX antibody (70R-5444) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors