ERAS antibody (70R-5731)

Rabbit polyclonal ERAS antibody raised against the middle region of ERAS

Synonyms Polyclonal ERAS antibody, Anti-ERAS antibody, Es Cell Expressed Ras antibody, MGC126693 antibody, MGC126691 antibody, HRAS2 antibody, HRASP antibody
Specificity ERAS antibody was raised against the middle region of ERAS
Cross Reactivity Human,Mouse
Applications WB
Immunogen ERAS antibody was raised using the middle region of ERAS corresponding to a region with amino acids AQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF
Assay Information ERAS Blocking Peptide, catalog no. 33R-1453, is also available for use as a blocking control in assays to test for specificity of this ERAS antibody

Images

Western Blot analysis using ERAS antibody (70R-5731)

ERAS antibody (70R-5731) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERAS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. ERAS plays an important role in the tumor-like growth properties of embryonic stem cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ERAS antibody (70R-5731) | ERAS antibody (70R-5731) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors