ERCC4 antibody (70R-2117)

Rabbit polyclonal ERCC4 antibody raised against the middle region of Ercc4

Synonyms Polyclonal ERCC4 antibody, Anti-ERCC4 antibody, XPF antibody, Excision Repair Cross-Complementing Rodent Repair Deficiency Complementation Group 4 antibody, RAD1 antibody
Specificity ERCC4 antibody was raised against the middle region of Ercc4
Cross Reactivity Human
Applications WB
Immunogen ERCC4 antibody was raised using the middle region of Ercc4 corresponding to a region with amino acids FLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST
Assay Information ERCC4 Blocking Peptide, catalog no. 33R-2974, is also available for use as a blocking control in assays to test for specificity of this ERCC4 antibody

Images

Western Blot analysis using ERCC4 antibody (70R-2117)

ERCC4 antibody (70R-2117) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 101 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERCC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ERCC4 antibody (70R-2117) | ERCC4 antibody (70R-2117) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors