ERCC5 antibody (70R-3326)

Rabbit polyclonal ERCC5 antibody raised against the N terminal of ERCC5

Synonyms Polyclonal ERCC5 antibody, Anti-ERCC5 antibody, COFS3 antibody, XPGC antibody, XPG antibody, Xeroderma Pigmentosum Complementation Group G antibody, UVDR antibody, Excision Repair Cross-Complementing Rodent Repair Deficiency Complementation Group 5 antibody, ERCM2 antibody
Specificity ERCC5 antibody was raised against the N terminal of ERCC5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ERCC5 antibody was raised using the N terminal of ERCC5 corresponding to a region with amino acids NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ
Assay Information ERCC5 Blocking Peptide, catalog no. 33R-6828, is also available for use as a blocking control in assays to test for specificity of this ERCC5 antibody

Images

Western Blot analysis using ERCC5 antibody (70R-3326)

ERCC5 antibody (70R-3326) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 133 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERCC5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage. Mutations cause Cockayne syndrome, which is characterized by severe growth defects, mental retardation, and cachexia. Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ERCC5 antibody (70R-3326) | ERCC5 antibody (70R-3326) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors