ERI2 antibody (70R-3113)

Rabbit polyclonal ERI2 antibody raised against the middle region of ERI2

Synonyms Polyclonal ERI2 antibody, Anti-ERI2 antibody, MGC16943 antibody, ERI 2 antibody, ERI 2, ERI-2, ERI-2 antibody, KIAA1504 antibody, ERI2, Eri1 Exoribonuclease Family Member 2 antibody
Specificity ERI2 antibody was raised against the middle region of ERI2
Cross Reactivity Human,Mouse
Applications WB
Immunogen ERI2 antibody was raised using the middle region of ERI2 corresponding to a region with amino acids LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP
Assay Information ERI2 Blocking Peptide, catalog no. 33R-5308, is also available for use as a blocking control in assays to test for specificity of this ERI2 antibody


Western Blot analysis using ERI2 antibody (70R-3113)

ERI2 antibody (70R-3113) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERI2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EXOD1 belongs to the EXOD1 family. It contains 1 exonuclease domain. EXOD1 is a member of a new subclass of exonucleases called the 3'hExo/ERI-1 subfamily of DEDDh nucleases.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ERI2 antibody (70R-3113) | ERI2 antibody (70R-3113) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors