ERLIN2 antibody (70R-5388)

Rabbit polyclonal ERLIN2 antibody raised against the middle region of ERLIN2

Synonyms Polyclonal ERLIN2 antibody, Anti-ERLIN2 antibody, Erlin-2 antibody, C8orf2 antibody, SPFH2 antibody, MGC87072 antibody, Er Lipid Raft Associated 2 antibody
Specificity ERLIN2 antibody was raised against the middle region of ERLIN2
Cross Reactivity Human
Applications WB
Immunogen ERLIN2 antibody was raised using the middle region of ERLIN2 corresponding to a region with amino acids ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN
Assay Information ERLIN2 Blocking Peptide, catalog no. 33R-1518, is also available for use as a blocking control in assays to test for specificity of this ERLIN2 antibody

Images

Western Blot analysis using ERLIN2 antibody (70R-5388)

ERLIN2 antibody (70R-5388) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERLIN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ERLIN2 antibody (70R-5388) | ERLIN2 antibody (70R-5388) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors