ERMAP antibody (70R-7347)

Rabbit polyclonal ERMAP antibody

Synonyms Polyclonal ERMAP antibody, Anti-ERMAP antibody, RD antibody, Scianna Blood Group antibody, SC antibody, MGC118813 antibody, PRO2801 antibody, Erythroblast Membrane-Associated Protein antibody, MGC118811 antibody, MGC118810 antibody, MGC118812 antibody
Cross Reactivity Human
Applications WB
Immunogen ERMAP antibody was raised using a synthetic peptide corresponding to a region with amino acids RSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDR
Assay Information ERMAP Blocking Peptide, catalog no. 33R-8176, is also available for use as a blocking control in assays to test for specificity of this ERMAP antibody

Images

Western Blot analysis using ERMAP antibody (70R-7347)

ERMAP antibody (70R-7347) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERMAP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ERMAP is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in the gene encoding ERMAP protein are responsible for the Scianna/Radin blood group system. The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ERMAP antibody (70R-7347) | ERMAP antibody (70R-7347) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors