ERP29 antibody (70R-6713)

Rabbit polyclonal ERP29 antibody raised against the N terminal of ERP29

Synonyms Polyclonal ERP29 antibody, Anti-ERP29 antibody, ERP 29, ERp28 antibody, ERP 29 antibody, C12orf8 antibody, PDI-DB antibody, ERP29, ERP-29, ERP-29 antibody, Endoplasmic Reticulum Protein 29 antibody, ERp31 antibody
Specificity ERP29 antibody was raised against the N terminal of ERP29
Cross Reactivity Human
Applications WB
Immunogen ERP29 antibody was raised using the N terminal of ERP29 corresponding to a region with amino acids MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI
Assay Information ERP29 Blocking Peptide, catalog no. 33R-5588, is also available for use as a blocking control in assays to test for specificity of this ERP29 antibody

Images

Western Blot analysis using ERP29 antibody (70R-6713)

ERP29 antibody (70R-6713) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERP29 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ERP29 antibody (70R-6713) | ERP29 antibody (70R-6713) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors