ESD antibody (70R-3731)

Rabbit polyclonal ESD antibody raised against the N terminal of ESD

Synonyms Polyclonal ESD antibody, Anti-ESD antibody, Esterase D/Formylglutathione Hydrolase antibody
Specificity ESD antibody was raised against the N terminal of ESD
Cross Reactivity Human
Applications WB
Immunogen ESD antibody was raised using the N terminal of ESD corresponding to a region with amino acids MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW
Assay Information ESD Blocking Peptide, catalog no. 33R-5690, is also available for use as a blocking control in assays to test for specificity of this ESD antibody


Western Blot analysis using ESD antibody (70R-3731)

ESD antibody (70R-3731) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ESD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ESD is a serine hydrolase involved in the detoxification of formaldehyde.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ESD antibody (70R-3731) | ESD antibody (70R-3731) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors