ESRRG antibody (70R-1940)

Rabbit polyclonal ESRRG antibody raised against the N terminal of ESRRG

Synonyms Polyclonal ESRRG antibody, Anti-ESRRG antibody, KIAA0832 antibody, DKFZp781L1617 antibody, Estrogen-Related Receptor Gamma antibody, FLJ16023 antibody, ERR3 antibody, NR3B3 antibody
Specificity ESRRG antibody was raised against the N terminal of ESRRG
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ESRRG antibody was raised using the N terminal of ESRRG corresponding to a region with amino acids DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN
Assay Information ESRRG Blocking Peptide, catalog no. 33R-2143, is also available for use as a blocking control in assays to test for specificity of this ESRRG antibody


Western blot analysis using ESRRG antibody (70R-1940)

Recommended ESRRG Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ESRRG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using ESRRG antibody (70R-1940) | Recommended ESRRG Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors