Estrogen Receptor 1 antibody (70R-5681)

Rabbit polyclonal Estrogen Receptor 1 antibody raised against the middle region of ESR1

Synonyms Polyclonal Estrogen Receptor 1 antibody, Anti-Estrogen Receptor 1 antibody, ER antibody, Era antibody, ESR antibody, DKFZp686N23123 antibody, NR3A1 antibody, ESR1 antibody, ESRA antibody
Specificity Estrogen Receptor 1 antibody was raised against the middle region of ESR1
Cross Reactivity Human
Applications WB
Immunogen Estrogen Receptor 1 antibody was raised using the middle region of ESR1 corresponding to a region with amino acids LLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAE
Assay Information Estrogen Receptor 1 Blocking Peptide, catalog no. 33R-5132, is also available for use as a blocking control in assays to test for specificity of this Estrogen Receptor 1 antibody

Images

Western blot analysis using Estrogen Receptor 1 antibody (70R-5681)

Recommended ESR1 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ESR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using Estrogen Receptor 1 antibody (70R-5681) | Recommended ESR1 Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using Estrogen Receptor 1 antibody (70R-5681) | Tissue analyzed: Human Fetal Muscle; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using Estrogen Receptor 1 antibody (70R-5681) | Tissue analyzed: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors