ETFB antibody (70R-2458)

Rabbit polyclonal ETFB antibody raised against the C terminal of ETFB

Synonyms Polyclonal ETFB antibody, Anti-ETFB antibody, Electron-Transfer-Flavoprotein Beta Polypeptide antibody, FP585 antibody, MADD antibody
Specificity ETFB antibody was raised against the C terminal of ETFB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP
Assay Information ETFB Blocking Peptide, catalog no. 33R-8967, is also available for use as a blocking control in assays to test for specificity of this ETFB antibody

Images

Western Blot analysis using ETFB antibody (70R-2458)

ETFB antibody (70R-2458) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ETFB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ETFB is the electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ETFB antibody (70R-2458) | ETFB antibody (70R-2458) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors