EWSR1 antibody (70R-5013)

Rabbit polyclonal EWSR1 antibody raised against the N terminal of EWSR1

Synonyms Polyclonal EWSR1 antibody, Anti-EWSR1 antibody, EWSR 1, EWSR-1 antibody, EWSR 1 antibody, AC002059.7 antibody, EWS antibody, EWSR1, Ewing Sarcoma Breakpoint Region 1 antibody, EWSR-1
Specificity EWSR1 antibody was raised against the N terminal of EWSR1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ
Assay Information EWSR1 Blocking Peptide, catalog no. 33R-7315, is also available for use as a blocking control in assays to test for specificity of this EWSR1 antibody

Images

Western Blot analysis using EWSR1 antibody (70R-5013)

EWSR1 antibody (70R-5013) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EWSR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EWSR1 is a putative RNA binding protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EWSR1 antibody (70R-5013) | EWSR1 antibody (70R-5013) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors