EXOC5 antibody (70R-3820)

Rabbit polyclonal EXOC5 antibody raised against the N terminal of EXOC5

Synonyms Polyclonal EXOC5 antibody, Anti-EXOC5 antibody, SEC10L1 antibody, EXOC-5 antibody, PRO1912 antibody, EXOC5, SEC10 antibody, HSEC10 antibody, Exocyst Complex Component 5 antibody, EXOC 5, DKFZp666H126 antibody, SEC10P antibody, EXOC 5 antibody, EXOC-5
Specificity EXOC5 antibody was raised against the N terminal of EXOC5
Cross Reactivity Human
Applications WB
Immunogen EXOC5 antibody was raised using the N terminal of EXOC5 corresponding to a region with amino acids ATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKI
Assay Information EXOC5 Blocking Peptide, catalog no. 33R-1562, is also available for use as a blocking control in assays to test for specificity of this EXOC5 antibody

Western Blot analysis using EXOC5 antibody (70R-3820)

EXOC5 antibody (70R-3820) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EXOC5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using EXOC5 antibody (70R-3820) | EXOC5 antibody (70R-3820) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors