EXOC6 antibody (70R-3769)

Rabbit polyclonal EXOC6 antibody raised against the N terminal of EXOC6

Synonyms Polyclonal EXOC6 antibody, Anti-EXOC6 antibody, Exocyst Complex Component 6 antibody, Sec15p antibody, EXOC 6, EXOC 6 antibody, SEC15L1 antibody, EXOC6, DKFZp761I2124 antibody, SEC15L antibody, FLJ1125 antibody, SEC15L3 antibody, FLJ11251 antibody, EXOC6A antibody, EXOC-6 antibody, MGC33397 antibody, EXOC-6
Specificity EXOC6 antibody was raised against the N terminal of EXOC6
Cross Reactivity Human
Applications WB
Immunogen EXOC6 antibody was raised using the N terminal of EXOC6 corresponding to a region with amino acids MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI
Assay Information EXOC6 Blocking Peptide, catalog no. 33R-6184, is also available for use as a blocking control in assays to test for specificity of this EXOC6 antibody


Western Blot analysis using EXOC6 antibody (70R-3769)

EXOC6 antibody (70R-3769) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EXOC6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EXOC6 antibody (70R-3769) | EXOC6 antibody (70R-3769) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors