EXOC8 antibody (70R-4492)

Rabbit polyclonal EXOC8 antibody raised against the N terminal of EXOC8

Synonyms Polyclonal EXOC8 antibody, Anti-EXOC8 antibody, SEC84 antibody, EXOC-8, Exocyst Complex Component 8 antibody, EXOC 8 antibody, Exo84p antibody, EXO84 antibody, EXOC 8, EXOC-8 antibody, EXOC8
Specificity EXOC8 antibody was raised against the N terminal of EXOC8
Cross Reactivity Human
Applications WB
Immunogen EXOC8 antibody was raised using the N terminal of EXOC8 corresponding to a region with amino acids MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQA
Assay Information EXOC8 Blocking Peptide, catalog no. 33R-5702, is also available for use as a blocking control in assays to test for specificity of this EXOC8 antibody


Western Blot analysis using EXOC8 antibody (70R-4492)

EXOC8 antibody (70R-4492) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EXOC8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EXOC8 is the component of the exocyst complex involved in the docking of exocystic vesicles with fusion sites on the plasma membrane.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EXOC8 antibody (70R-4492) | EXOC8 antibody (70R-4492) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors