EXOSC10 antibody (70R-1331)

Rabbit polyclonal EXOSC10 antibody raised against the C terminal of EXOSC10

Synonyms Polyclonal EXOSC10 antibody, Anti-EXOSC10 antibody, EXOSC 10 antibody, EXOSC-10 antibody, Exosome Component 10 antibody, EXOSC 10, EXOSC10, EXOSC-10
Specificity EXOSC10 antibody was raised against the C terminal of EXOSC10
Cross Reactivity Human
Applications IHC, WB
Immunogen EXOSC10 antibody was raised using the C terminal of EXOSC10 corresponding to a region with amino acids FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG
Assay Information EXOSC10 Blocking Peptide, catalog no. 33R-2842, is also available for use as a blocking control in assays to test for specificity of this EXOSC10 antibody

Images

Western Blot analysis using EXOSC10 antibody (70R-1331)

EXOSC10 antibody (70R-1331) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EXOSC10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EXOSC10 contains 1 HRDC domain and 1 3'-5' exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EXOSC10 antibody (70R-1331) | EXOSC10 antibody (70R-1331) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors