EXOSC2 antibody (70R-4705)

Rabbit polyclonal EXOSC2 antibody raised against the middle region of EXOSC2

Synonyms Polyclonal EXOSC2 antibody, Anti-EXOSC2 antibody, EXOSC-2, EXOSC 2 antibody, hRrp4p antibody, EXOSC2, RRP4 antibody, EXOSC 2, Exosome Component 2 antibody, p7 antibody, Rrp4p antibody, EXOSC-2 antibody
Specificity EXOSC2 antibody was raised against the middle region of EXOSC2
Cross Reactivity Human,Mouse
Applications WB
Immunogen EXOSC2 antibody was raised using the middle region of EXOSC2 corresponding to a region with amino acids AEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCG
Assay Information EXOSC2 Blocking Peptide, catalog no. 33R-1154, is also available for use as a blocking control in assays to test for specificity of this EXOSC2 antibody


Western Blot analysis using EXOSC2 antibody (70R-4705)

EXOSC2 antibody (70R-4705) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EXOSC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EXOSC2 antibody (70R-4705) | EXOSC2 antibody (70R-4705) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors