EXOSC3 antibody (70R-4694)

Rabbit polyclonal EXOSC3 antibody raised against the middle region of EXOSC3

Synonyms Polyclonal EXOSC3 antibody, Anti-EXOSC3 antibody, EXOSC3, EXOSC 3 antibody, Exosome Component 3 antibody, EXOSC-3 antibody, EXOSC 3, EXOSC-3
Specificity EXOSC3 antibody was raised against the middle region of EXOSC3
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen EXOSC3 antibody was raised using the middle region of EXOSC3 corresponding to a region with amino acids TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK
Assay Information EXOSC3 Blocking Peptide, catalog no. 33R-9133, is also available for use as a blocking control in assays to test for specificity of this EXOSC3 antibody

Images

Immunohistochemical staining using EXOSC3 antibody (70R-4694)

EXOSC3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EXOSC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using EXOSC3 antibody (70R-4694) | EXOSC3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using EXOSC3 antibody (70R-4694) | EXOSC3 antibody (70R-4694) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors