EXOSC6 antibody (70R-4889)

Rabbit polyclonal EXOSC6 antibody raised against the N terminal of EXOSC6

Synonyms Polyclonal EXOSC6 antibody, Anti-EXOSC6 antibody, EXOSC-6 antibody, EXOSC 6, EXOSC 6 antibody, EXOSC6, EXOSC-6, Exosome Component 6 antibody
Specificity EXOSC6 antibody was raised against the N terminal of EXOSC6
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen EXOSC6 antibody was raised using the N terminal of EXOSC6 corresponding to a region with amino acids LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG
Assay Information EXOSC6 Blocking Peptide, catalog no. 33R-5560, is also available for use as a blocking control in assays to test for specificity of this EXOSC6 antibody


Western Blot analysis using EXOSC6 antibody (70R-4889)

EXOSC6 antibody (70R-4889) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EXOSC6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EXOSC6 constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EXOSC6 antibody (70R-4889) | EXOSC6 antibody (70R-4889) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors