EXT2 antibody (70R-5708)

Rabbit polyclonal EXT2 antibody

Synonyms Polyclonal EXT2 antibody, Anti-EXT2 antibody, SOTV antibody, Exostoses 2 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen EXT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRW
Assay Information EXT2 Blocking Peptide, catalog no. 33R-6672, is also available for use as a blocking control in assays to test for specificity of this EXT2 antibody


Western Blot analysis using EXT2 antibody (70R-5708)

EXT2 antibody (70R-5708) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EXT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EXT2 is one of two glycosyltransferases involved in the chain elongation step of heparan sulfate biosynthesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EXT2 antibody (70R-5708) | EXT2 antibody (70R-5708) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors