F11R Blocking Peptide (33R-10403)

A synthetic peptide for use as a blocking control in assays to test for specificity of F11R antibody, catalog no. 70R-10301

Synonyms F11R control peptide, F11R antibody Blocking Peptide, Anti-F11R Blocking Peptide, F11 receptor Blocking Peptide, CD321 Blocking Peptide, JAM Blocking Peptide, JAM1 Blocking Peptide, JAMA Blocking Peptide, JCAM Blocking Peptide, KAT Blocking Peptide, PAM-1 Blocking Peptide, F11R, FR-11, FR 11, FR-11 Blocking Peptide, FR 11 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPMTSNAVRMEAVE
Molecular Weight 33 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is an important regulator of tight junction assembly in epithelia. In addition, the encoded protein can act as (1) a receptor for reovirus, (2) a ligand for the integrin LFA1, involved in leukocyte transmigration, and (3) a platelet receptor. Multiple 5' alternatively spliced variants, encoding the same protein, have been identified but their biological validity has not been established.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors