FAAH2 antibody (70R-7541)

Rabbit polyclonal FAAH2 antibody raised against the C terminal of FAAH2

Synonyms Polyclonal FAAH2 antibody, Anti-FAAH2 antibody, FAAH-2 antibody, FLJ31204 antibody, Fatty Acid Amide Hydrolase 2 antibody, RP11-479E16 antibody, AMDD antibody
Specificity FAAH2 antibody was raised against the C terminal of FAAH2
Cross Reactivity Human
Applications WB
Immunogen FAAH2 antibody was raised using the C terminal of FAAH2 corresponding to a region with amino acids SPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKE
Assay Information FAAH2 Blocking Peptide, catalog no. 33R-8683, is also available for use as a blocking control in assays to test for specificity of this FAAH2 antibody

Images

Western Blot analysis using FAAH2 antibody (70R-7541)

FAAH2 antibody (70R-7541) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAAH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Fatty acid amide hydrolases, such as FAAH1 and FAAH2, hydrolyze primary fatty acid amide substrates and may play a role in fatty acid catabolism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAAH2 antibody (70R-7541) | FAAH2 antibody (70R-7541) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors