Factor II antibody (70R-5684)

Rabbit polyclonal Factor II antibody

Synonyms Polyclonal Factor II antibody, Anti-Factor II antibody, CF2R antibody, HTR antibody, F2R antibody, Coagulation Factor Ii antibody, TR antibody, PAR1 antibody, Thrombin Receptor antibody
Cross Reactivity Human
Applications WB
Immunogen Factor II antibody was raised using a synthetic peptide corresponding to a region with amino acids KYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSW
Assay Information Factor II Blocking Peptide, catalog no. 33R-4737, is also available for use as a blocking control in assays to test for specificity of this Factor II antibody

Images

Western Blot analysis using Factor II antibody (70R-5684)

Factor II antibody (70R-5684) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of F2R antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Coagulation factor II receptor(F2R) is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Factor II antibody (70R-5684) | Factor II antibody (70R-5684) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors