Factor X antibody (70R-7485)

Rabbit polyclonal Factor X antibody raised against the C terminal of F10

Synonyms Polyclonal Factor X antibody, Anti-Factor X antibody, FXA antibody, FX antibody, Coagulation Factor X antibody, F10 antibody
Specificity Factor X antibody was raised against the C terminal of F10
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Factor X antibody was raised using the C terminal of F10 corresponding to a region with amino acids STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQ
Assay Information Factor X Blocking Peptide, catalog no. 33R-8874, is also available for use as a blocking control in assays to test for specificity of this Factor X antibody

Images

Western Blot analysis using Factor X antibody (70R-7485)

Factor X antibody (70R-7485) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of F10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance F10 is the vitamin K-dependent coagulation factor X of the blood coagulation cascade. This factor undergoes multiple processing steps before its preproprotein is converted to a mature two-chain form by the excision of the tripeptide RKR. Two chains of the factor are held together by 1 or more disulfide bonds; the light chain contains 2 EGF-like domains, while the heavy chain contains the catalytic domain which is structurally homologous to those of the other hemostatic serine proteases. The mature factor is activated by the cleavage of the activation peptide by factor IXa (in the intrisic pathway), or by factor VIIa (in the extrinsic pathway). The activated factor then converts prothrombin to thrombin in the presence of factor Va, Ca+2, and phospholipid during blood clotting.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Factor X antibody (70R-7485) | Factor X antibody (70R-7485) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors