Factor XIII B Polypeptide antibody (70R-5446)

Rabbit polyclonal Factor XIII B Polypeptide antibody raised against the middle region of F13B

Synonyms Polyclonal Factor XIII B Polypeptide antibody, Anti-Factor XIII B Polypeptide antibody, F13B antibody, Coagulation Factor Xiii B Polypeptide antibody, FXIIIB antibody
Specificity Factor XIII B Polypeptide antibody was raised against the middle region of F13B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Factor XIII B Polypeptide antibody was raised using the middle region of F13B corresponding to a region with amino acids LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP
Assay Information Factor XIII B Polypeptide Blocking Peptide, catalog no. 33R-5367, is also available for use as a blocking control in assays to test for specificity of this Factor XIII B Polypeptide antibody


Western Blot analysis using Factor XIII B Polypeptide antibody (70R-5446)

Factor XIII B Polypeptide antibody (70R-5446) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of F13B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance F13B contains 10 Sushi (CCP/SCR) domains. The B chain of factor XIII is not catalytically active, but is thought to stabilize the A subunits and regulate the rate of transglutaminase formation by thrombin. Defects in F13B can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Factor XIII B Polypeptide antibody (70R-5446) | Factor XIII B Polypeptide antibody (70R-5446) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors