FADD antibody (70R-3423)

Rabbit polyclonal FADD antibody

Synonyms Polyclonal FADD antibody, Anti-FADD antibody, Tnfrsf6-Associated Via Death Domain antibody, Mort1/FADD antibody, Fas antibody
Cross Reactivity mouse
Applications WB
Immunogen FADD antibody was raised using a synthetic peptide corresponding to a region with amino acids ASVAGLVKALRTCRLNLVADLVEEAQESVSKSENMSPVLRDSTVSSSETP
Assay Information FADD Blocking Peptide, catalog no. 33R-1537, is also available for use as a blocking control in assays to test for specificity of this FADD antibody


Western Blot analysis using FADD antibody (70R-3423)

FADD antibody (70R-3423) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FADD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Fadd is apoptotic adaptor molecule that recruits caspase-8 or caspase-10 to the activated Fas (CD95) or TNFR-1 receptors. The resulting aggregate called the death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation. Active caspase-8 initiates the subsequent cascade of caspases mediating apoptosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FADD antibody (70R-3423) | FADD antibody (70R-3423) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors