FADS1 antibody (70R-1837)

Rabbit polyclonal FADS1 antibody raised against the C terminal of FADS1

Synonyms Polyclonal FADS1 antibody, Anti-FADS1 antibody, Fatty Acid Desaturase 1 antibody, FADS6 antibody, FADS-1 antibody, BC269730_2 antibody, D5D antibody, FADSD5 antibody, FLJ90273 antibody, FADS1, TU12 antibody, LLCDL1 antibody, FADS 1 antibody, FADS-1, FADS 1
Specificity FADS1 antibody was raised against the C terminal of FADS1
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen FADS1 antibody was raised using the C terminal of FADS1 corresponding to a region with amino acids FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL
Assay Information FADS1 Blocking Peptide, catalog no. 33R-3002, is also available for use as a blocking control in assays to test for specificity of this FADS1 antibody

Images

Immunohistochemical staining using FADS1 antibody (70R-1837)

FADS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FADS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FADS1 is a member of the fatty acid desaturase (FADS) family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using FADS1 antibody (70R-1837) | FADS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows)  in Human Muscle. Magnification is at 400X
  • Western Blot analysis using FADS1 antibody (70R-1837) | FADS1 antibody (70R-1837) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors