FAH antibody (70R-1062)

Rabbit polyclonal FAH antibody

Synonyms Polyclonal FAH antibody, Anti-FAH antibody, Fumarylacetoacetase antibody, Fumarylacetoacetate Hydrolase antibody
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen FAH antibody was raised using a synthetic peptide corresponding to a region with amino acids AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG
Assay Information FAH Blocking Peptide, catalog no. 33R-1054, is also available for use as a blocking control in assays to test for specificity of this FAH antibody


Immunohistochemical staining using FAH antibody (70R-1062)

FAH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FAH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using FAH antibody (70R-1062) | FAH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using FAH antibody (70R-1062) | FAH antibody (70R-1062) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using FAH antibody (70R-1062) | FAH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors