FAM101A antibody (70R-3401)

Rabbit polyclonal FAM101A antibody raised against the middle region of FAM101A

Synonyms Polyclonal FAM101A antibody, Anti-FAM101A antibody, FAM 101, FAM101, FLJ44614 antibody, FAM 101 antibody, FAM-101, FAM-101 antibody, Family With Sequence Similarity 101 Member A antibody
Specificity FAM101A antibody was raised against the middle region of FAM101A
Cross Reactivity Human
Applications WB
Immunogen FAM101A antibody was raised using the middle region of FAM101A corresponding to a region with amino acids QLTLEPRPRALRFRSTTIIFPKHARSTFRTTLHCSLGRPSRWFTASVQLQ
Assay Information FAM101A Blocking Peptide, catalog no. 33R-7649, is also available for use as a blocking control in assays to test for specificity of this FAM101A antibody


Western Blot analysis using FAM101A antibody (70R-3401)

FAM101A antibody (70R-3401) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM101A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM101A belongs to the FAM101 family. The exact function of FAM101A remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM101A antibody (70R-3401) | FAM101A antibody (70R-3401) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors