FAM105A antibody (70R-6746)

Rabbit polyclonal FAM105A antibody raised against the N terminal of FAM105A

Synonyms Polyclonal FAM105A antibody, Anti-FAM105A antibody, FAM-105 antibody, FLJ11127 antibody, FAM105, FAM 105 antibody, Family With Sequence Similarity 105 Member A antibody, FAM-105, FAM 105
Specificity FAM105A antibody was raised against the N terminal of FAM105A
Cross Reactivity Human
Applications WB
Immunogen FAM105A antibody was raised using the N terminal of FAM105A corresponding to a region with amino acids HKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEE
Assay Information FAM105A Blocking Peptide, catalog no. 33R-3765, is also available for use as a blocking control in assays to test for specificity of this FAM105A antibody

Images

Western Blot analysis using FAM105A antibody (70R-6746)

FAM105A antibody (70R-6746) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM105A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM105A belongs to the FAM105 family. The exact function of FAM105A remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM105A antibody (70R-6746) | FAM105A antibody (70R-6746) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors