FAM105A antibody (70R-6892)

Rabbit polyclonal FAM105A antibody raised against the middle region of FAM105A

Synonyms Polyclonal FAM105A antibody, Anti-FAM105A antibody, FAM-105 antibody, FAM 105 antibody, FAM-105, FAM 105, Family With Sequence Similarity 105 Member A antibody, FLJ11127 antibody, FAM105
Specificity FAM105A antibody was raised against the middle region of FAM105A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM105A antibody was raised using the middle region of FAM105A corresponding to a region with amino acids QYSFGPEKYTGSNVFGKLRKYVELLKTQWTEFNGIRDYHKRGSMCNTLFS
Assay Information FAM105A Blocking Peptide, catalog no. 33R-7795, is also available for use as a blocking control in assays to test for specificity of this FAM105A antibody

Images

Western Blot analysis using FAM105A antibody (70R-6892)

FAM105A antibody (70R-6892) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM105A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM105A belongs to the FAM105 family. The exact function of FAM105A remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM105A antibody (70R-6892) | FAM105A antibody (70R-6892) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors