FAM108B1 antibody (70R-3168)

Rabbit polyclonal FAM108B1 antibody raised against the middle region of FAM108B1

Synonyms Polyclonal FAM108B1 antibody, Anti-FAM108B1 antibody, FAM-108, FAM108, RP11-409O11.2 antibody, C9orf77 antibody, Family With Sequence Similarity 108 Member B1 antibody, FAM-108 antibody, FAM 108, FAM 108 antibody, CGI-67 antibody
Specificity FAM108B1 antibody was raised against the middle region of FAM108B1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM108B1 antibody was raised using the middle region of FAM108B1 corresponding to a region with amino acids SSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRY
Assay Information FAM108B1 Blocking Peptide, catalog no. 33R-8802, is also available for use as a blocking control in assays to test for specificity of this FAM108B1 antibody


Western Blot analysis using FAM108B1 antibody (70R-3168)

FAM108B1 antibody (70R-3168) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM108B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM108B1 belongs to the AB hydrolase superfamily.fAM108 family. The exact function of FAM108B1 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM108B1 antibody (70R-3168) | FAM108B1 antibody (70R-3168) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors