FAM109A antibody (70R-4010)

Rabbit polyclonal FAM109A antibody raised against the N terminal of FAM109A

Synonyms Polyclonal FAM109A antibody, Anti-FAM109A antibody, FAM-109 antibody, FAM 109, FAM 109 antibody, Family With Sequence Similarity 109 Member A antibody, FLJ32356 antibody, FAM-109, FAM109
Specificity FAM109A antibody was raised against the N terminal of FAM109A
Cross Reactivity Human
Applications WB
Immunogen FAM109A antibody was raised using the N terminal of FAM109A corresponding to a region with amino acids HRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFA
Assay Information FAM109A Blocking Peptide, catalog no. 33R-3848, is also available for use as a blocking control in assays to test for specificity of this FAM109A antibody

Images

Western Blot analysis using FAM109A antibody (70R-4010)

FAM109A antibody (70R-4010) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM109A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance the FAM109A protein localizes to the endosome and interacts with the enzyme, inositol polyphosphate 5-phosphatase OCRL-1. Alternate splicing results in multiple transcript variants.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM109A antibody (70R-4010) | FAM109A antibody (70R-4010) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors