FAM116A antibody (70R-4205)

Rabbit polyclonal FAM116A antibody raised against the middle region of FAM116A

Synonyms Polyclonal FAM116A antibody, Anti-FAM116A antibody, FAM116, FAM 116 antibody, Family With Sequence Similarity 116 Member A antibody, FAM-116 antibody, FLJ34969 antibody, FAM 116, FAM-116
Specificity FAM116A antibody was raised against the middle region of FAM116A
Cross Reactivity Human,Rat
Applications WB
Immunogen FAM116A antibody was raised using the middle region of FAM116A corresponding to a region with amino acids KPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYFLELTQSF
Assay Information FAM116A Blocking Peptide, catalog no. 33R-4585, is also available for use as a blocking control in assays to test for specificity of this FAM116A antibody


Western Blot analysis using FAM116A antibody (70R-4205)

FAM116A antibody (70R-4205) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM116A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM116A belongs to the FAM116 family. The exact function of FAM116A remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM116A antibody (70R-4205) | FAM116A antibody (70R-4205) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors