FAM118A antibody (70R-4554)

Rabbit polyclonal FAM118A antibody raised against the middle region of FAM118A

Synonyms Polyclonal FAM118A antibody, Anti-FAM118A antibody, C22orf8 antibody, FAM-118 antibody, FAM 118, Family With Sequence Similarity 118 Member A antibody, FAM-118, FAM 118 antibody, FAM118, FLJ20635 antibody
Specificity FAM118A antibody was raised against the middle region of FAM118A
Cross Reactivity Human
Applications WB
Immunogen FAM118A antibody was raised using the middle region of FAM118A corresponding to a region with amino acids EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL
Assay Information FAM118A Blocking Peptide, catalog no. 33R-2802, is also available for use as a blocking control in assays to test for specificity of this FAM118A antibody

Images

Western Blot analysis using FAM118A antibody (70R-4554)

FAM118A antibody (70R-4554) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM118A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM118 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM118A antibody (70R-4554) | FAM118A antibody (70R-4554) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors