FAM119A antibody (70R-3617)

Rabbit polyclonal FAM119A antibody raised against the N terminal of FAM119A

Synonyms Polyclonal FAM119A antibody, Anti-FAM119A antibody, FAM 119 antibody, FAM-119 antibody, FAM 119, FAM119, FAM-119, Family With Sequence Similarity 119 Member A antibody, MGC45373 antibody
Specificity FAM119A antibody was raised against the N terminal of FAM119A
Cross Reactivity Human,Mouse
Applications WB
Immunogen FAM119A antibody was raised using the N terminal of FAM119A corresponding to a region with amino acids ALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAI
Assay Information FAM119A Blocking Peptide, catalog no. 33R-1379, is also available for use as a blocking control in assays to test for specificity of this FAM119A antibody


Western Blot analysis using FAM119A antibody (70R-3617)

FAM119A antibody (70R-3617) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM119A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM119A is a multi-pass membrane protein. It belongs to the FAM119 family. The function of the FAM119A protein remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM119A antibody (70R-3617) | FAM119A antibody (70R-3617) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors