FAM124A antibody (70R-3890)

Rabbit polyclonal FAM124A antibody raised against the middle region of FAM124A

Synonyms Polyclonal FAM124A antibody, Anti-FAM124A antibody, FAM-124 antibody, FAM 124, Family With Sequence Similarity 124A antibody, FAM 124 antibody, FLJ30707 antibody, FAM124, FAM-124
Specificity FAM124A antibody was raised against the middle region of FAM124A
Cross Reactivity Human
Applications WB
Immunogen FAM124A antibody was raised using the middle region of FAM124A corresponding to a region with amino acids VSRVTTEASWASLPFFTKRSSSSSATARAAPPAPSTSTLTDSSPQLPCDT
Assay Information FAM124A Blocking Peptide, catalog no. 33R-9824, is also available for use as a blocking control in assays to test for specificity of this FAM124A antibody

Images

Western Blot analysis using FAM124A antibody (70R-3890)

FAM124A antibody (70R-3890) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM124A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM124A protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM124A antibody (70R-3890) | FAM124A antibody (70R-3890) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors