FAM134A antibody (70R-6908)

Rabbit polyclonal FAM134A antibody raised against the N terminal of FAM134A

Synonyms Polyclonal FAM134A antibody, Anti-FAM134A antibody, FAM 134, MGC3035 antibody, FAM 134 antibody, C2orf17 antibody, DKFZp686C2379 antibody, FAM134, Family With Sequence Similarity 134 Member A antibody, FAM-134, FAM-134 antibody
Specificity FAM134A antibody was raised against the N terminal of FAM134A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM134A antibody was raised using the N terminal of FAM134A corresponding to a region with amino acids AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCS
Assay Information FAM134A Blocking Peptide, catalog no. 33R-1221, is also available for use as a blocking control in assays to test for specificity of this FAM134A antibody

Images

Western Blot analysis using FAM134A antibody (70R-6908)

FAM134A antibody (70R-6908) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM134A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM134 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM134A antibody (70R-6908) | FAM134A antibody (70R-6908) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors