FAM134B antibody (70R-1786)

Rabbit polyclonal FAM134B antibody raised against the middle region of Fam134B

Synonyms Polyclonal FAM134B antibody, Anti-FAM134B antibody, FAM-134, FLJ22155 antibody, FAM-134 antibody, FAM 134, FLJ20152 antibody, FAM134, FAM 134 antibody, Family With Sequence Similarity 134 Member B antibody, FLJ22179 antibody
Specificity FAM134B antibody was raised against the middle region of Fam134B
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen FAM134B antibody was raised using the middle region of Fam134B corresponding to a region with amino acids LSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDF
Assay Information FAM134B Blocking Peptide, catalog no. 33R-5466, is also available for use as a blocking control in assays to test for specificity of this FAM134B antibody


Immunohistochemical staining using FAM134B antibody (70R-1786)

FAM134B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar ceils (arrows) in Human Lung. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FAM134B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.625 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM134B is required for the long-term survival of nociceptive and autonomic ganglion neurons.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using FAM134B antibody (70R-1786) | FAM134B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar ceils (arrows)  in Human Lung. Magnification is at 400X
  • Western Blot analysis using FAM134B antibody (70R-1786) | FAM134B antibody (70R-1786) used at 0.625 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors