FAM13C1 antibody (70R-3463)

Rabbit polyclonal FAM13C1 antibody raised against the N terminal of FAM13C1

Synonyms Polyclonal FAM13C1 antibody, Anti-FAM13C1 antibody, FAM-13, MGC33233 antibody, FAM13, Family With Sequence Similarity 13 Member C1 antibody, FAM 13 antibody, FAM 13, FAM-13 antibody
Specificity FAM13C1 antibody was raised against the N terminal of FAM13C1
Cross Reactivity Human
Applications WB
Immunogen FAM13C1 antibody was raised using the N terminal of FAM13C1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD
Assay Information FAM13C1 Blocking Peptide, catalog no. 33R-9039, is also available for use as a blocking control in assays to test for specificity of this FAM13C1 antibody

Images

Western Blot analysis using FAM13C1 antibody (70R-3463)

FAM13C1 antibody (70R-3463) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM13C1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM13C1 antibody (70R-3463) | FAM13C1 antibody (70R-3463) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors