FAM19A3 antibody (70R-6402)

Rabbit polyclonal FAM19A3 antibody raised against the middle region of FAM19A3

Synonyms Polyclonal FAM19A3 antibody, Anti-FAM19A3 antibody, FAM-193 antibody, Family With Sequence Similarity 19 antibody, FAM-193, FAM193, TAFA3 antibody, TAFA-3 antibody, MGC138473 antibody, FAM 193 antibody, FAM 193
Specificity FAM19A3 antibody was raised against the middle region of FAM19A3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM19A3 antibody was raised using the middle region of FAM19A3 corresponding to a region with amino acids FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAALRLLLPQPPSSCRDGGV
Assay Information FAM19A3 Blocking Peptide, catalog no. 33R-3058, is also available for use as a blocking control in assays to test for specificity of this FAM19A3 antibody

Images

Western Blot analysis using FAM19A3 antibody (70R-6402)

FAM19A3 antibody (70R-6402) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM19A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM19A3 is a member of the TAFA family which is composed of five highly homologous small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM19A3 antibody (70R-6402) | FAM19A3 antibody (70R-6402) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors