FAM19A4 antibody (70R-6561)

Rabbit polyclonal FAM19A4 antibody raised against the middle region of FAM19A4

Synonyms Polyclonal FAM19A4 antibody, Anti-FAM19A4 antibody, FLJ25161 antibody, Family With Sequence Similarity 19 antibody, FAM-194, TAFA-4 antibody, TAFA4 antibody, FAM 194, FAM-194 antibody, FAM194, FAM 194 antibody
Specificity FAM19A4 antibody was raised against the middle region of FAM19A4
Cross Reactivity Human
Applications WB
Immunogen FAM19A4 antibody was raised using the middle region of FAM19A4 corresponding to a region with amino acids SSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVA
Assay Information FAM19A4 Blocking Peptide, catalog no. 33R-8840, is also available for use as a blocking control in assays to test for specificity of this FAM19A4 antibody

Images

Western Blot analysis using FAM19A4 antibody (70R-6561)

FAM19A4 antibody (70R-6561) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM19A4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Transcript variants with different 5' UTRs, but encoding the same protein, have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM19A4 antibody (70R-6561) | FAM19A4 antibody (70R-6561) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors