FAM20C antibody (70R-6352)

Rabbit polyclonal FAM20C antibody raised against the middle region of FAM20C

Synonyms Polyclonal FAM20C antibody, Anti-FAM20C antibody, FAM 20 antibody, FAM-20, FAM20, Family With Sequence Similarity 20 Member C antibody, DMP4 antibody, FAM 20, RNS antibody, FAM-20 antibody
Specificity FAM20C antibody was raised against the middle region of FAM20C
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM20C antibody was raised using the middle region of FAM20C corresponding to a region with amino acids CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSY
Assay Information FAM20C Blocking Peptide, catalog no. 33R-1689, is also available for use as a blocking control in assays to test for specificity of this FAM20C antibody

Images

Western Blot analysis using FAM20C antibody (70R-6352)

FAM20C antibody (70R-6352) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM20C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM20C antibody (70R-6352) | FAM20C antibody (70R-6352) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors