FAM29A antibody (70R-3438)

Rabbit polyclonal FAM29A antibody raised against the middle region of Fam29A

Synonyms Polyclonal FAM29A antibody, Anti-FAM29A antibody, FAM 29, FAM-29, MGC138798 antibody, FAM 29 antibody, MGC102696 antibody, MGC138799 antibody, FAM29, RP11-296P7.3 antibody, FAM-29 antibody, Family With Sequence Similarity 29 Member A antibody
Specificity FAM29A antibody was raised against the middle region of Fam29A
Cross Reactivity Human
Applications WB
Immunogen FAM29A antibody was raised using the middle region of Fam29A corresponding to a region with amino acids RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT
Assay Information FAM29A Blocking Peptide, catalog no. 33R-8198, is also available for use as a blocking control in assays to test for specificity of this FAM29A antibody

Images

Western Blot analysis using FAM29A antibody (70R-3438)

FAM29A antibody (70R-3438) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 108 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM29A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM29A is required for progression through mitosis. FAM29A promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-tubulin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM29A antibody (70R-3438) | FAM29A antibody (70R-3438) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors